PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG666800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 572aa    MW: 63551.4 Da    PI: 4.6119
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG666800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS426.12.8e-1302025712374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cA+a+s+ +  +aqa+++ l++++s +gdp qR+aay++e+Laar++ s++++ykal++++ +   +  +l+a+++++e++P++
  Pavir.5KG666800.1.p 202 KQLLFDCATALSEYNIDEAQAIISDLRQMVSIQGDPSQRIAAYLVEGLAARIVASGNGIYKALTCKDPP---TLYQLSAMQILFEICPCF 288
                          589*****************************************************************9...89999************* PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          ++++++aN aIlea  geer+HiiDfdi+qG Q+++L+q L + +++p +lRiTgv++pe++      l+ +g+rL+++A+ +gv+fef+
  Pavir.5KG666800.1.p 289 RLGFMAANYAILEACRGEERLHIIDFDINQGSQYITLIQFLKNNANKPQHLRITGVDDPETVqrPIGGLKVIGQRLEQLAQDCGVSFEFR 378
                          ************************************************************99878899********************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + v  +l d+++ +L+++pgEalaVn+++qlh+l+desvs+ +erd++L++vk+l+Pk+v++veq+a++n+++Fl+rf e  +yy+alfd
  Pavir.5KG666800.1.p 379 A-VGANLGDVTPAMLDCRPGEALAVNFAFQLHHLPDESVSIMNERDQLLRMVKGLQPKLVTLVEQDANTNTAPFLTRFREVYDYYAALFD 467
                          *.799************************************************************************************* PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                          sl+a+lpres +r++vEr++l+reivn++aceg +r+er e ++kWr+r+++aGF+p p+++++ + +k++l+ + ++ y+ ee++g l 
  Pavir.5KG666800.1.p 468 SLDATLPRESPDRMNVERQCLAREIVNILACEGPDRVERYEVAGKWRARMTMAGFTPCPFNSNVINGMKSILKSYCDR-YKFEEDHGGLH 556
                          ****************************************************************************66.*********** PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          +gW +++L++ SaW+
  Pavir.5KG666800.1.p 557 FGWGEKTLIVSSAWQ 571
                          **************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.778175552IPR005202Transcription factor GRAS
PfamPF035149.7E-128202571IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MSFVRRADPS TAYTDNLYIH KFAASSSNFA VRRFSSDTQL FRYGPEPYNG EYGHMGFIGS  60
PSAAFQNSFC SQQASLTPYP LNADGRSPSV ADTQSNSCSD AAKESPVASN VSQQNSQSVS  120
DTQSSEIEVE FDEDEIRLKL QELEHALLED GDDILFEISQ ASSINDEWTD PMKNVLLPNS  180
PKESESSINC AVSNSRATRT PKQLLFDCAT ALSEYNIDEA QAIISDLRQM VSIQGDPSQR  240
IAAYLVEGLA ARIVASGNGI YKALTCKDPP TLYQLSAMQI LFEICPCFRL GFMAANYAIL  300
EACRGEERLH IIDFDINQGS QYITLIQFLK NNANKPQHLR ITGVDDPETV QRPIGGLKVI  360
GQRLEQLAQD CGVSFEFRAV GANLGDVTPA MLDCRPGEAL AVNFAFQLHH LPDESVSIMN  420
ERDQLLRMVK GLQPKLVTLV EQDANTNTAP FLTRFREVYD YYAALFDSLD ATLPRESPDR  480
MNVERQCLAR EIVNILACEG PDRVERYEVA GKWRARMTMA GFTPCPFNSN VINGMKSILK  540
SYCDRYKFEE DHGGLHFGWG EKTLIVSSAW Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-552035716375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.116080.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970786.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLK3XG130.0K3XG13_SETIT; Uncharacterized protein
STRINGSi000832m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1